PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01g012070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 258aa    MW: 29496.3 Da    PI: 7.4696
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01g012070.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.74.2e-135712395
                    .HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3 23 aeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                    ++++ g  +e +  ++l++  s  +W+vk+  ++++    ltkGWk+F+ +++L++gD+vvF++dg     ++v+
  Csa01g012070.1  5 LRHIdGPTNEDNAVVKLRSdVSDITWQVKM--EGRR----LTKGWKKFAASHDLRVGDIVVFRHDGG--LLFHVT 71
                    44444333344556777766888*******..8888....***********************8763..333555 PP

2B356.93.7e-18116209399
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      + +++++l+++ l lp+ f +++g+ k++  +++l +e+g  W++ l+  k +g+++++ GW++F+ +n+L+++D++ +kl++ +++++v++++
  Csa01g012070.1 116 VARVTASNLRKDSLFLPRGFSRSNGLMKRKC-EIILLNEDGIPWKLILS-HKPDGEVYIRLGWRSFCFENRLRVNDVLSLKLVQ-TGTTPVLQLC 207
                     556789999***************9998765.****************4.33334599************************99.88889**999 PP

                     -S CS
              B3  98 rk 99 
                     ++
  Csa01g012070.1 208 SS 209
                     86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010192.2E-5176IPR003340B3 DNA binding domain
PROSITE profilePS5086311.603176IPR003340B3 DNA binding domain
PfamPF023628.7E-9365IPR003340B3 DNA binding domain
CDDcd100171.83E-13473No hitNo description
SuperFamilySSF1019362.75E-151383IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-171783IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-19107209IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.0E-20108209IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.239114209IPR003340B3 DNA binding domain
SMARTSM010195.9E-25114210IPR003340B3 DNA binding domain
CDDcd100173.37E-19114208No hitNo description
PfamPF023627.6E-17116209IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MRFFLRHIDG PTNEDNAVVK LRSDVSDITW QVKMEGRRLT KGWKKFAASH DLRVGDIVVF  60
RHDGGLLFHV TCFGPSCCEI QYDYDDVIQI SSDSDSENNQ NIADEGSSSD HHSCFVARVT  120
ASNLRKDSLF LPRGFSRSNG LMKRKCEIIL LNEDGIPWKL ILSHKPDGEV YIRLGWRSFC  180
FENRLRVNDV LSLKLVQTGT TPVLQLCSSS TTSQNRFLTL TLKPYNLKKY KLVSEWYRES  240
EENNSRGSIQ YQTDDES*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010488930.11e-172PREDICTED: B3 domain-containing protein REM10-like
TrEMBLR0HQ081e-118R0HQ08_9BRAS; Uncharacterized protein (Fragment)
STRINGfgenesh1_pm.C_scaffold_30009201e-111(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.12e-58B3 family protein